OLA1 antibody
-
- Target See all OLA1 Antibodies
- OLA1 (Obg-Like ATPase 1 (OLA1))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OLA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYH
- Top Product
- Discover our top product OLA1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GTPBP9 Blocking Peptide, catalog no. 33R-3413, is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OLA1 (Obg-Like ATPase 1 (OLA1))
- Alternative Name
- GTPBP9 (OLA1 Products)
- Synonyms
- MGC79585 antibody, PTD004 antibody, GTPBP9 antibody, DOC45 antibody, GBP45 antibody, GTBP9 antibody, 2510025G09Rik antibody, 2810405J23Rik antibody, 2810409H07Rik antibody, Gtpbp9 antibody, RGD1307982 antibody, fe36h01 antibody, wu:fc66b09 antibody, wu:fe36h01 antibody, wu:fk82a02 antibody, zgc:55768 antibody, zgc:85691 antibody, Obg-like ATPase 1 antibody, Obg like ATPase 1 antibody, Obg-like ATPase 1 L homeolog antibody, ola1 antibody, OLA1 antibody, Ola1 antibody, ola1.L antibody
- Background
- GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
- Molecular Weight
- 44 kDa (MW of target protein)
-