CLIC2 antibody (C-Term)
-
- Target See all CLIC2 Antibodies
- CLIC2 (Chloride Intracellular Channel 2 (CLIC2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLIC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLIC2 antibody was raised against the C terminal of CLIC2
- Purification
- Purified
- Immunogen
- CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG
- Top Product
- Discover our top product CLIC2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLIC2 Blocking Peptide, catalog no. 33R-8293, is also available for use as a blocking control in assays to test for specificity of this CLIC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLIC2 (Chloride Intracellular Channel 2 (CLIC2))
- Alternative Name
- CLIC2 (CLIC2 Products)
- Synonyms
- zgc:92762 antibody, CLIC2 antibody, CLIC2b antibody, MRXS32 antibody, XAP121 antibody, chloride intracellular channel 2 antibody, clic2 antibody, CLIC2 antibody, Clic2 antibody
- Background
- Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity
-