Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Superoxide Dismutase 1, Soluble (SOD1) antibody

Antigen

Superoxide Dismutase 1, Soluble (SOD1)
Synonyms
ALS, SOD, ALS1, IPOA, homodimer, Cu, Zn Sod, Zn-SOD, Cu-Zn SOD, Cu/Zn SOD, Cu/Zn superoxide dismutase, Cu/ZnSOD, CuSOD, CuZn SOD, CuZn-SOD, CuZnSOD, Cu[2+]/Zn[2+]SOD, G, SOD-1, SOD1, To, To-1, cSOD, l ... show more
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Catalog no. ABIN630121
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Alternative name SOD1
Immunogen SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
Description SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.
Molecular Weight 16 kDa (MW of target protein)
Synonyms ALS, SOD, ALS1, IPOA, homodimer, Cu, Zn Sod, Zn-SOD, Cu-Zn SOD, Cu/Zn SOD, Cu/Zn superoxide dismutase, Cu/ZnSOD, CuSOD, CuZn SOD, CuZn-SOD, CuZnSOD, Cu[2+]/Zn[2+]SOD, G, SOD-1, SOD1, To, To-1, cSOD, l(3)108, l(3)68Af', l(3)G, DmelCG11793, CG11793, LOC692639, CU/ZN-SOD, sod1, SODC, DKFZP469M1833

Application Details
Alternatives Secondary Antibodies Variants back to top

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SOD1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "Superoxide Dismutase 1, Soluble (SOD1)", type "Antibodies"
Hosts Rabbit (68), Mouse (35), Goat (8), Sheep (4), Chicken (1)
Reactivities Human (71), Cow (Bovine) (27), Rat (Rattus) (20), Mouse (Murine) (19), Dog (Canine) (8), Guinea Pig (5), Coral (4), Hamster (4), Monkey (4), Pig (Porcine) (4), Rabbit (4), Sheep (Ovine) (4), Xenopus laevis (4), Horse (Equine) (2), Arabidopsis thaliana (1), Olive (Olea europaea)(Pollen) (1), Spinach (Spinacia oleracea) (1)
Applications Western Blotting (WB) (99), ELISA (50), Immunoprecipitation (IP) (39), Immunohistochemistry (IHC) (25), Enzyme Immunoassay (EIA) (24), Immunohistochemistry (Frozen Sections) (IHC (fro)) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (14), Immunofluorescence (IF) (7), Flow Cytometry (FACS) (5), Immunocytochemistry (ICC) (5), Immunodiffusion (ID) (3), Dot Blot (Dot) (2), ELISA (Detection) (2), Radioimmunoassay (RIA) (2)
Conjugates HRP (4), Biotin (1)
Epitopes internal (2), AA 100-115 (1), AA 24-39 (1), AA 43-57 (1), AA 58-72 (1), AA 80-96 (1), Center (1), N-Term (1), aa 03-20 (1), aa 131-153 (1)