Nucleobindin 1 antibody (C-Term)

Catalog No. ABIN630154

Product Details anti-Nucleobindin 1 Antibody

Target: Nucleobindin 1 (NUCB1)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nucleobindin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Purification: Purified

Immunogen: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nucleobindin 1

Target: Nucleobindin 1 (NUCB1)

Alternative Name: Nucleobindin 1 (NUCB1 Products)

Synonyms: nuc antibody, MGC69294 antibody, MGC81496 antibody, NUCB1 antibody, zgc:153192 antibody, DKFZp459O1814 antibody, B230337F23Rik antibody, C77483 antibody, Calnuc antibody, MTEST82 antibody, Nucb antibody, CALNUC antibody, NUC antibody, nucleobindin 1 antibody, nucleobindin 1 S homeolog antibody, nucb1 antibody, nucb1.S antibody, NUCB1 antibody, Nucb1 antibody

Background: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis.

Molecular Weight: 51 kDa (MW of target protein)