Septin 6 antibody (Middle Region)
-
- Target See all Septin 6 (SEPT6) Antibodies
- Septin 6 (SEPT6)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Septin 6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Septin 6 antibody was raised against the middle region of 40427
- Purification
- Purified
- Immunogen
- Septin 6 antibody was raised using the middle region of 40427 corresponding to a region with amino acids CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
- Top Product
- Discover our top product SEPT6 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 38961 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Septin 6 (SEPT6)
- Alternative Name
- Septin 6 (SEPT6 Products)
- Synonyms
- SEP2 antibody, SEPT2 antibody, sept11 antibody, SEPT11 antibody, 2810035H17Rik antibody, C920001C06Rik antibody, Sep6 antibody, mKIAA0128 antibody, Sep2 antibody, fc54b04 antibody, wu:fb70g05 antibody, wu:fc54b04 antibody, wu:fl76c07 antibody, zgc:66071 antibody, septin-6 antibody, septin 6 antibody, septin 6 L homeolog antibody, SEPT6 antibody, sept6.L antibody, Sept6 antibody, sept6 antibody, LOC100220762 antibody
- Background
- SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.
- Molecular Weight
- 50 kDa (MW of target protein)
-