NOLC1 antibody (C-Term)

Catalog No. ABIN630195

Product Details anti-NOLC1 Antibody

Target: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse, Dog, Drosophila melanogaster, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOLC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NOLC1 antibody was raised against the C terminal of NOLC1

Purification: Purified

Immunogen: NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOLC1 Blocking Peptide, catalog no. 33R-2089, is also available for use as a blocking control in assays to test for specificity of this NOLC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOLC1

Target: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Alternative Name: NOLC1 (NOLC1 Products)

Synonyms: NOPP130 antibody, NOPP140 antibody, NS5ATP13 antibody, P130 antibody, Nopp140 antibody, 3230402K17Rik antibody, AA408077 antibody, AA536818 antibody, AU046071 antibody, mKIAA0035 antibody, nolc1 antibody, fd05f01 antibody, fi49h02 antibody, nolc1l antibody, wu:fd05f01 antibody, wu:fi49h02 antibody, NOLC1 antibody, DKFZp459M126 antibody, nopp130 antibody, nopp140 antibody, ns5atp13 antibody, p130 antibody, xNopp180 antibody, nucleolar and coiled-body phosphoprotein 1 antibody, nucleolar and coiled-body phosphoprotein 1 L homeolog antibody, NOLC1 antibody, Nolc1 antibody, nolc1 antibody, nolc1.L antibody

Background: Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling