NSDHL antibody

Catalog No. ABIN630356

Product Details anti-NSDHL Antibody

Target: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSDHL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSDHL Blocking Peptide, catalog no. 33R-7828, is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSDHL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSDHL

Target: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Alternative Name: NSDHL (NSDHL Products)

Synonyms: zgc:112474 antibody, H105E3 antibody, SDR31E1 antibody, XAP104 antibody, AI747449 antibody, Bpa antibody, Str antibody, NAD(P) dependent steroid dehydrogenase-like antibody, NAD(P) dependent steroid dehydrogenase-like L homeolog antibody, NSDHL antibody, nsdhl antibody, nsdhl.L antibody, Nsdhl antibody

Background: NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.

Molecular Weight: 42 kDa (MW of target protein)