SLC19A1 antibody
-
- Target See all SLC19A1 Antibodies
- SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC19A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
- Top Product
- Discover our top product SLC19A1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC19A1 Blocking Peptide, catalog no. 33R-6599, is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))
- Alternative Name
- SLC19A1 (SLC19A1 Products)
- Synonyms
- A1 antibody, MHCBFB antibody, PO-GA antibody, RECC1 antibody, RFC antibody, RFC140 antibody, CHMD antibody, FOLT antibody, IFC1 antibody, REFC antibody, RFC1 antibody, LOC100226745 antibody, AI323572 antibody, RFC-1 antibody, MTX1 antibody, XRFC antibody, chmd antibody, folt antibody, ifc1 antibody, refc antibody, rfc1 antibody, slc19a1 antibody, replication factor C subunit 1 antibody, solute carrier family 19 member 1 antibody, folate transporter 1 antibody, solute carrier family 19 (folate transporter), member 1 antibody, solute carrier family 19 (folate transporter), member 1 L homeolog antibody, RFC1 antibody, SLC19A1 antibody, LOC100226745 antibody, Slc19a1 antibody, slc19a1.L antibody
- Background
- Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-