FNDC3B antibody (N-Term)

Catalog No. ABIN630408

Product Details anti-FNDC3B Antibody

Target: FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FNDC3B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FNDC3 B antibody was raised against the N terminal of FNDC3

Purification: Purified

Immunogen: FNDC3 B antibody was raised using the N terminal of FNDC3 corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FNDC3B Blocking Peptide, catalog no. 33R-7822, is also available for use as a blocking control in assays to test for specificity of this FNDC3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FNDC3B

Target: FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))

Alternative Name: FNDC3B (FNDC3B Products)

Synonyms: FAD104 antibody, PRO4979 antibody, YVTM2421 antibody, 1600019O04Rik antibody, AW550168 antibody, Fad104 antibody, mKIAA4164 antibody, RGD1311673 antibody, FNDC3B antibody, DKFZp469D136 antibody, fibronectin type III domain containing 3B antibody, FNDC3B antibody, Fndc3b antibody, fndc3b antibody

Background: FNDC3B may be a positive regulator of adipogenesis.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Positive Regulation of fat Cell Differentiation