SLC46A3 antibody (N-Term)

Catalog No. ABIN630428

Product Details anti-SLC46A3 Antibody

Target: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC46A3 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: SLC46 A3 antibody was raised against the N terminal of SLC46 3

Purification: Purified

Immunogen: SLC46 A3 antibody was raised using the N terminal of SLC46 3 corresponding to a region with amino acids MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC46A3 Blocking Peptide, catalog no. 33R-6144, is also available for use as a blocking control in assays to test for specificity of this SLC46A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC46A3

Target: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Alternative Name: SLC46A3 (SLC46A3 Products)

Synonyms: SLC46A3 antibody, DKFZp469J2134 antibody, FKSG16 antibody, 1200006F02Rik antibody, RGD1307594 antibody, solute carrier family 46 member 3 antibody, solute carrier family 46, member 3 antibody, SLC46A3 antibody, slc46a3 antibody, Slc46a3 antibody

Background: The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)