TFAM antibody (Middle Region)

Catalog No. ABIN630521

Product Details anti-TFAM Antibody

Target: TFAM (Transcription Factor A, Mitochondrial (TFAM))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TFAM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TFAM antibody was raised against the middle region of TFAM

Purification: Affinity purified

Immunogen: TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TFAM Blocking Peptide, catalog no. 33R-4982, is also available for use as a blocking control in assays to test for specificity of this TFAM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TFAM

Target: TFAM (Transcription Factor A, Mitochondrial (TFAM))

Alternative Name: TFAM (TFAM Products)

Synonyms: tcf6 antibody, mttf1 antibody, mttfa antibody, tcf6l1 antibody, tcf6l2 antibody, tcf6l3 antibody, mttfa-A antibody, xl-mtTFA antibody, MGC153358 antibody, zgc:153358 antibody, MTTF1 antibody, MTTFA antibody, TCF6 antibody, TCF6L1 antibody, TCF6L2 antibody, TCF6L3 antibody, AI661103 antibody, Hmgts antibody, mtTFA antibody, tsHMG antibody, Mttfa antibody, transcription factor A, mitochondrial antibody, transcription factor A, mitochondrial L homeolog antibody, TFAM antibody, tfam.L antibody, tfam antibody, Tfam antibody

Background: TFAM is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Chromatin Binding