ZNF33A antibody (Middle Region)
-
- Target See all ZNF33A Antibodies
- ZNF33A (Zinc Finger Protein 33A (ZNF33A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZNF33A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZNF33 A antibody was raised against the middle region of ZNF33
- Purification
- Affinity purified
- Immunogen
- ZNF33 A antibody was raised using the middle region of ZNF33 corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD
- Top Product
- Discover our top product ZNF33A Primary Antibody
-
-
- Application Notes
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZNF33A Blocking Peptide, catalog no. 33R-5320, is also available for use as a blocking control in assays to test for specificity of this ZNF33A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZNF33A (Zinc Finger Protein 33A (ZNF33A))
- Alternative Name
- ZNF33A (ZNF33A Products)
- Synonyms
- KOX2 antibody, KOX31 antibody, KOX5 antibody, NF11A antibody, ZNF11 antibody, ZNF11A antibody, ZNF33 antibody, ZZAPK antibody, zinc finger protein 33A antibody, ZNF33A antibody
- Background
- ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.
- Molecular Weight
- 80 kDa (MW of target protein)
-