C18orf54 antibody

Catalog No. ABIN630532

Product Details anti-C18orf54 Antibody

Target: C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C18orf54 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: C18 ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C18ORF54 Blocking Peptide, catalog no. 33R-7000, is also available for use as a blocking control in assays to test for specificity of this C18ORF54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C18orf54

Target: C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))

Alternative Name: C18ORF54 (C18orf54 Products)

Synonyms: LAS2 antibody, 9930107F24 antibody, BB148262 antibody, Lars antibody, Las2 antibody, chromosome 18 open reading frame 54 antibody, RIKEN cDNA 4930503L19 gene antibody, c18orf54 antibody, C18orf54 antibody, 4930503L19Rik antibody

Background: The function of C18orf54 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 58 kDa (MW of target protein)