C21ORF56 antibody

Catalog No. ABIN630544

Product Details anti-C21ORF56 Antibody

Target: C21ORF56 (C21orf56) (Chromosome 21 Open Reading Frame 56 (C21orf56))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21ORF56 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: C21 ORF56 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF56 Blocking Peptide, catalog no. 33R-2511, is also available for use as a blocking control in assays to test for specificity of this C21ORF56 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21ORF56

Target: C21ORF56 (C21orf56) (Chromosome 21 Open Reading Frame 56 (C21orf56))

Alternative Name: C21ORF56 (C21orf56 Products)

Synonyms: C21orf56 antibody, spermatogenesis and centriole associated 1 like antibody, SPATC1L antibody

Background: The function of C21orf56 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 21 kDa (MW of target protein)