TRMT5 antibody

Catalog No. ABIN630573

Product Details anti-TRMT5 Antibody

Target: TRMT5 (tRNA Methyltransferase 5 (TRMT5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRMT5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRMT5 Blocking Peptide, catalog no. 33R-2587, is also available for use as a blocking control in assays to test for specificity of this TRMT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRMT5

Target: TRMT5 (tRNA Methyltransferase 5 (TRMT5))

Alternative Name: TRMT5 (TRMT5 Products)

Synonyms: RGD1306567 antibody, 2610027O18Rik antibody, mKIAA1393 antibody, wu:fi28b08 antibody, KIAA1393 antibody, TRM5 antibody, tRNA methyltransferase 5 antibody, TRM5 tRNA methyltransferase 5 antibody, TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae) antibody, Trmt5 antibody, TRMT5 antibody, trmt5 antibody

Background: TRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.

Molecular Weight: 58 kDa (MW of target protein)