PNMA1 antibody (Middle Region)
-
- Target See all PNMA1 Antibodies
- PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNMA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNMA1 antibody was raised against the middle region of PNMA1
- Purification
- Affinity purified
- Immunogen
- PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH
- Top Product
- Discover our top product PNMA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNMA1 Blocking Peptide, catalog no. 33R-5249, is also available for use as a blocking control in assays to test for specificity of this PNMA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))
- Alternative Name
- PNMA1 (PNMA1 Products)
- Synonyms
- PNMA1 antibody, 5730402C15Rik antibody, MA1 antibody, PNMA family member 1 antibody, paraneoplastic antigen MA1 antibody, paraneoplastic Ma antigen 1 antibody, PNMA1 antibody, Pnma1 antibody
- Background
- PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.
- Molecular Weight
- 40 kDa (MW of target protein)
-