NUDT17 antibody
-
- Target See all NUDT17 Antibodies
- NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUDT17 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD
- Top Product
- Discover our top product NUDT17 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUDT17 Blocking Peptide, catalog no. 33R-10206, is also available for use as a blocking control in assays to test for specificity of this NUDT17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))
- Alternative Name
- NUDT17 (NUDT17 Products)
- Synonyms
- 2410015C20Rik antibody, RGD1565469 antibody, zgc:114128 antibody, nudix hydrolase 17 antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 17 antibody, NUDT17 antibody, Nudt17 antibody, nudt17 antibody
- Background
- NUDT17 belongs to the Nudix hydrolase family. It probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
- Molecular Weight
- 36 kDa (MW of target protein)
-