ECHDC1 antibody (Middle Region)

Catalog No. ABIN630734

Product Details anti-ECHDC1 Antibody

Target: ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ECHDC1 antibody was raised against the middle region of ECHDC1

Purification: Affinity purified

Immunogen: ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHDC1 Blocking Peptide, catalog no. 33R-3646, is also available for use as a blocking control in assays to test for specificity of this ECHDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHDC1

Target: ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))

Alternative Name: ECHDC1 (ECHDC1 Products)

Synonyms: MMCD antibody, dJ351K20.2 antibody, 1700028A24Rik antibody, AI314462 antibody, AI930038 antibody, D10Ertd667e antibody, MGC110060 antibody, zgc:110060 antibody, ethylmalonyl-CoA decarboxylase 1 antibody, ethylmalonyl-CoA decarboxylase 1 L homeolog antibody, enoyl Coenzyme A hydratase domain containing 1 antibody, enoyl CoA hydratase domain containing 1 antibody, echdc1 antibody, ECHDC1 antibody, echdc1.L antibody, Echdc1 antibody

Background: ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.

Molecular Weight: 33 kDa (MW of target protein)