MPP7 antibody
-
- Target See all MPP7 Antibodies
- MPP7 (Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPP7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MPP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL
- Top Product
- Discover our top product MPP7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPP7 Blocking Peptide, catalog no. 33R-6270, is also available for use as a blocking control in assays to test for specificity of this MPP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPP7 (Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7))
- Alternative Name
- MPP7 (MPP7 Products)
- Synonyms
- 1110068J02Rik antibody, 2810038M04Rik antibody, 5430426E14Rik antibody, AI415104 antibody, Gm955 antibody, dlg3 antibody, hmp antibody, membrane palmitoylated protein 7 antibody, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7) antibody, membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) antibody, MPP7 antibody, Mpp7 antibody, mpp7a antibody
- Background
- MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-