CA1 antibody (N-Term)

Catalog No. ABIN630776

Product Details anti-CA1 Antibody

Target: CA1 (Carbonic Anhydrase I (CA1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Carbonic Anhydrase I antibody was raised against the N terminal of CA1

Purification: Affinity purified

Immunogen: Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonic Anhydrase I Blocking Peptide, catalog no. 33R-1519, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CA1

Target: CA1 (Carbonic Anhydrase I (CA1))

Alternative Name: Carbonic Anhydrase I (CA1 Products)

Synonyms: CA-I antibody, CAB antibody, Car1 antibody, AW555628 antibody, Ca1 antibody, Car-1 antibody, BG:DS00941.1 antibody, CAH antibody, CG7820 antibody, Dmel\\CG7820 antibody, Gh7 antibody, ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING PROTEIN 3 antibody, ATBCA1 antibody, ATSABP3 antibody, BETA CARBONIC ANHYDRASE 1 antibody, F4P13.5 antibody, F4P13_5 antibody, SABP3 antibody, SALICYLIC ACID-BINDING PROTEIN 3 antibody, carbonic anhydrase 1 antibody, CA1 antibody, LOC100135826 antibody, GB15888 antibody, carbonic anhydrase 1 antibody, Carbonic anhydrase 1 antibody, carbonic anhydrase I antibody, carbonic anhydrase antibody, CA1 antibody, Car1 antibody, CAH1 antibody, LOC100135826 antibody, LOC408827 antibody, Tsp_05114 antibody, LOC100153915 antibody, LOC100050192 antibody, Ca1 antibody

Background: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes.

Molecular Weight: 29 kDa (MW of target protein)