GABARAP antibody
-
- Target See all GABARAP Antibodies
- GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GABARAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV
- Top Product
- Discover our top product GABARAP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GABARAP Blocking Peptide, catalog no. 33R-4382, is also available for use as a blocking control in assays to test for specificity of this GABARAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))
- Alternative Name
- GABARAP (GABARAP Products)
- Synonyms
- GABARAP antibody, ATG8A antibody, GABARAP-a antibody, MM46 antibody, gabarap antibody, mg:bb02b03 antibody, GABA type A receptor-associated protein antibody, gamma-aminobutyric acid receptor-associated protein antibody, GABA(A) receptor-associated protein a antibody, gamma-aminobutyric acid receptor associated protein antibody, GABARAP antibody, LOC5568843 antibody, Gabarap antibody, gabarapa antibody
- Background
- Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
- Molecular Weight
- 14 kDa (MW of target protein)
- Pathways
- Autophagy
-