SPDYA antibody

Catalog No. ABIN630819

Product Details anti-SPDYA Antibody

Target: SPDYA (Speedy Homolog A (SPDYA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPDYA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SPDYA antibody was raised using a synthetic peptide corresponding to a region with amino acids MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPDYA Blocking Peptide, catalog no. 33R-6362, is also available for use as a blocking control in assays to test for specificity of this SPDYA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPDYA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPDYA

Target: SPDYA (Speedy Homolog A (SPDYA))

Alternative Name: SPDYA (SPDYA Products)

Synonyms: zgc:101624 antibody, 4921517J08Rik antibody, 4930548B21Rik antibody, GS4 antibody, MLZ-465 antibody, Spdy1 antibody, RINGO antibody, SPDY1 antibody, RINGO3 antibody, RINGOA antibody, SPY1 antibody, Gs4 antibody, Lm23 antibody, Spy1 antibody, speedy homolog A (Xenopus laevis) antibody, speedy/RINGO cell cycle regulator family member A antibody, speedy/RINGO cell cycle regulator family, member A antibody, SPDYA antibody, spdya antibody, Spdya antibody

Background: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Molecular Weight: 36 kDa (MW of target protein)