SYCP3 antibody (N-Term)

Catalog No. ABIN630844

Product Details anti-SYCP3 Antibody

Target: SYCP3 (Synaptonemal Complex Protein 3 (SYCP3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYCP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SYCP3 antibody was raised against the N terminal of SYCP3

Purification: Affinity purified

Immunogen: SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SYCP3 Blocking Peptide, catalog no. 33R-9825, is also available for use as a blocking control in assays to test for specificity of this SYCP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYCP3

Target: SYCP3 (Synaptonemal Complex Protein 3 (SYCP3))

Alternative Name: SYCP3 (SYCP3 Products)

Synonyms: Cor1 antibody, Scp3 antibody, COR1 antibody, SCP3 antibody, SPGF4 antibody, RNASCP3 antibody, SYCP3 antibody, sycp3 antibody, MGC146429 antibody, scp3 antibody, SCP-3 antibody, synaptonemal complex protein 3 antibody, synaptonemal complex protein 3 L homeolog antibody, Sycp3 antibody, SYCP3 antibody, sycp3 antibody, scp3 antibody, sycp3.L antibody

Background: SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.

Molecular Weight: 26 kDa (MW of target protein)