SYCP3 antibody (N-Term)
-
- Target See all SYCP3 Antibodies
- SYCP3 (Synaptonemal Complex Protein 3 (SYCP3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SYCP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SYCP3 antibody was raised against the N terminal of SYCP3
- Purification
- Affinity purified
- Immunogen
- SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE
- Top Product
- Discover our top product SYCP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SYCP3 Blocking Peptide, catalog no. 33R-9825, is also available for use as a blocking control in assays to test for specificity of this SYCP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYCP3 (Synaptonemal Complex Protein 3 (SYCP3))
- Alternative Name
- SYCP3 (SYCP3 Products)
- Synonyms
- Cor1 antibody, Scp3 antibody, COR1 antibody, SCP3 antibody, SPGF4 antibody, RNASCP3 antibody, SYCP3 antibody, sycp3 antibody, MGC146429 antibody, scp3 antibody, SCP-3 antibody, synaptonemal complex protein 3 antibody, synaptonemal complex protein 3 L homeolog antibody, Sycp3 antibody, SYCP3 antibody, sycp3 antibody, scp3 antibody, sycp3.L antibody
- Background
- SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.
- Molecular Weight
- 26 kDa (MW of target protein)
-