PPIL2 antibody
-
- Target See all PPIL2 Antibodies
- PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPIL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
- Top Product
- Discover our top product PPIL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPIL2 Blocking Peptide, catalog no. 33R-3545, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))
- Alternative Name
- PPIL2 (PPIL2 Products)
- Synonyms
- cyc4 antibody, cyp60 antibody, hcyp-60 antibody, CYC4 antibody, CYP60 antibody, Cyp-60 antibody, UBOX7 antibody, hCyP-60 antibody, 0610009L05Rik antibody, 1700016N17Rik antibody, 4921520K19Rik antibody, 4930511F14Rik antibody, AA589416 antibody, C130078A06Rik antibody, si:dkeyp-86g2.1 antibody, zgc:56616 antibody, zgc:86735 antibody, peptidylprolyl isomerase like 2 S homeolog antibody, peptidylprolyl isomerase like 2 antibody, peptidylprolyl isomerase (cyclophilin)-like 2 antibody, ppil2.S antibody, PPIL2 antibody, ppil2 antibody, Ppil2 antibody
- Background
- PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.
- Molecular Weight
- 59 kDa (MW of target protein)
-