Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SCO Cytochrome Oxidase Deficient Homolog 1 (Yeast) (SCO1) antibody

Antigen

SCO Cytochrome Oxidase Deficient Homolog 1 (Yeast) (SCO1)

Synonyms SCOD1, D11Bwg1310e, 2610001C07Rik, SCO1, RGD1559538, MGC143363
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630894
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name SCO1
Immunogen SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
Description Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.
Molecular Weight 34 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCO1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only

Alternatives

Alternatives for antigen "SCO Cytochrome Oxidase Deficient Homolog 1 (Yeast) (SCO1)", type "Antibodies"
Hosts Rabbit (1)
Reactivities Human (1)
Applications ELISA (1), Western Blotting (WB) (1)