Arylsulfatase A antibody (Middle Region)

Catalog No. ABIN630905

Product Details anti-Arylsulfatase A Antibody

Target: Arylsulfatase A (ARSA)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Arylsulfatase A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARSA antibody was raised against the middle region of ARSA

Purification: Affinity purified

Immunogen: ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARSA Blocking Peptide, catalog no. 33R-4608, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Arylsulfatase A

Target: Arylsulfatase A (ARSA)

Alternative Name: ARSA (ARSA Products)

Synonyms: ARSA antibody, zgc:101575 antibody, arsa antibody, AS-A antibody, ASA antibody, AW212749 antibody, As-2 antibody, As2 antibody, TISP73 antibody, MLD antibody, mld antibody, arylsulfatase A antibody, arylsulfatase antibody, arylsulfatase A, gene 1 S homeolog antibody, ARSA antibody, arsa antibody, arsA antibody, RB6599 antibody, Arsa antibody, arsa.1.S antibody

Background: ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).

Molecular Weight: 52 kDa (MW of target protein)