Arylsulfatase A antibody (Middle Region)
-
- Target See all Arylsulfatase A (ARSA) Antibodies
- Arylsulfatase A (ARSA)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Arylsulfatase A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARSA antibody was raised against the middle region of ARSA
- Purification
- Affinity purified
- Immunogen
- ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH
- Top Product
- Discover our top product ARSA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARSA Blocking Peptide, catalog no. 33R-4608, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Arylsulfatase A (ARSA)
- Alternative Name
- ARSA (ARSA Products)
- Synonyms
- ARSA antibody, zgc:101575 antibody, arsa antibody, AS-A antibody, ASA antibody, AW212749 antibody, As-2 antibody, As2 antibody, TISP73 antibody, MLD antibody, mld antibody, arylsulfatase A antibody, arylsulfatase antibody, arylsulfatase A, gene 1 S homeolog antibody, ARSA antibody, arsa antibody, arsA antibody, RB6599 antibody, Arsa antibody, arsa.1.S antibody
- Background
- ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).
- Molecular Weight
- 52 kDa (MW of target protein)
-