PSMA3 antibody
-
- Target See all PSMA3 Antibodies
- PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
- Top Product
- Discover our top product PSMA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMA3 Blocking Peptide, catalog no. 33R-8998, is also available for use as a blocking control in assays to test for specificity of this PSMA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))
- Alternative Name
- PSMA3 (PSMA3 Products)
- Synonyms
- HC8 antibody, PSC3 antibody, Psma3l antibody, psma3 antibody, im:6909944 antibody, zgc:114044 antibody, Lmpc8 antibody, proteasome subunit alpha 3 antibody, proteasome subunit alpha 3 L homeolog antibody, proteasome (prosome, macropain) subunit, alpha type 3 antibody, PSMA3 antibody, Psma3 antibody, psma3.L antibody, psma3 antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-