MTHFD1 antibody
-
- Target See all MTHFD1 Antibodies
- MTHFD1 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTHFD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
- Top Product
- Discover our top product MTHFD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTHFD1 Blocking Peptide, catalog no. 33R-8236, is also available for use as a blocking control in assays to test for specificity of this MTHFD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTHFD1 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1))
- Alternative Name
- MTHFD1 (MTHFD1 Products)
- Synonyms
- MTHFC antibody, MTHFD antibody, Tb07.27M11.970 antibody, Dcs antibody, E430024A07Rik antibody, Mthfd antibody, GB13160 antibody, cb325 antibody, fc29f07 antibody, mthfd1 antibody, wu:fc29f07 antibody, zgc:55597 antibody, methylenetetrahydrofolate dehydrogenase, cyclohydrolase and formyltetrahydrofolate synthetase 1 antibody, C-1-tetrahydrofolate synthase, cytoplasmic antibody, putative C-1-tetrahydrofolate synthase, cytoplasmic antibody, putative C-1-tetrahydrofolate synthase,cytoplasmic antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1 like antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent), methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthase antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1b antibody, c-1-tetrahydrofolate synthase, cytoplasmic antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase L homeolog antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase antibody, MTHFD1 antibody, Mthfd1 antibody, Tc00.1047053509509.20 antibody, Tc00.1047053511741.50 antibody, Tc00.1047053511517.60 antibody, Tc00.1047053508207.240 antibody, Tb927.7.1600 antibody, LINJ_26_0310 antibody, LBRM_26_0350 antibody, LMJF_26_0320 antibody, mthfd1l antibody, LOC550749 antibody, mthfd1b antibody, Tsp_00651 antibody, mthfd1.L antibody, mthfd1 antibody, LOC589933 antibody, LOC100634307 antibody
- Background
- MTHFD1 possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.
- Molecular Weight
- 101 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-