NAT15 antibody
-
- Target See all NAT15 Antibodies
- NAT15 (N-Acetyltransferase 15 (NAT15))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NAT15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
- Top Product
- Discover our top product NAT15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NAT15 Blocking Peptide, catalog no. 33R-2239, is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAT15 (N-Acetyltransferase 15 (NAT15))
- Alternative Name
- NAT15 (NAT15 Products)
- Synonyms
- nat15 antibody, im:7141641 antibody, naa60 antibody, zgc:163109 antibody, HAT4 antibody, NAT15 antibody, 1200013P24Rik antibody, AI315146 antibody, Nat15 antibody, RGD1308915 antibody, N(alpha)-acetyltransferase 60, NatF catalytic subunit antibody, N-acetyltransferase 15 (GCN5-related, putative) antibody, naa60 antibody, nat15 antibody, NAA60 antibody, Naa60 antibody
- Background
- NAT15 most likely functions as an N-acetyltransferase.
- Molecular Weight
- 27 kDa (MW of target protein)
-