TXN2 antibody (Middle Region)

Catalog No. ABIN631006

Product Details anti-TXN2 Antibody

Target: TXN2 (Thioredoxin 2 (TXN2))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Thioredoxin 2 antibody was raised against the middle region of TXN2

Purification: Affinity purified

Immunogen: Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Thioredoxin 2 Blocking Peptide, catalog no. 33R-9462, is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXN2

Target: TXN2 (Thioredoxin 2 (TXN2))

Alternative Name: Thioredoxin 2 (TXN2 Products)

Synonyms: MT-TRX antibody, MTRX antibody, TRX2 antibody, 31884 antibody, CG31884 antibody, CG3864 antibody, DTrx-2 antibody, DmTrx-2 antibody, DmelTrx-2 antibody, Dmel\\CG31884 antibody, Trx antibody, anon-WO0118547.188 antibody, dmtrx-2 antibody, 2510006J11Rik antibody, AI788873 antibody, Trx2 antibody, zgc:77127 antibody, thioredoxin 2 antibody, thioredoxin-2 antibody, thiol reductase thioredoxin antibody, thioredoxin 2 L homeolog antibody, TXN2 antibody, Trx-2 antibody, LOC409451 antibody, VPA0972 antibody, VS_RS18125 antibody, VCD_000568 antibody, VEA_000083 antibody, trx2 antibody, Txn2 antibody, txn2 antibody, txn2.L antibody

Background: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Molecular Weight: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis