MRPL48 antibody (Middle Region)
-
- Target See all MRPL48 Antibodies
- MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRPL48 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MRPL48 antibody was raised against the middle region of MRPL48
- Purification
- Affinity purified
- Immunogen
- MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK
- Top Product
- Discover our top product MRPL48 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRPL48 Blocking Peptide, catalog no. 33R-4469, is also available for use as a blocking control in assays to test for specificity of this MRPL48 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL48 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))
- Alternative Name
- MRPL48 (MRPL48 Products)
- Synonyms
- HSPC290 antibody, L48MT antibody, MRP-L48 antibody, 1810030E20Rik antibody, 2610028L11Rik antibody, CGI-118 antibody, D4Ertd786e antibody, mitochondrial ribosomal protein L48 antibody, MRPL48 antibody, Mrpl48 antibody
- Background
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
- Molecular Weight
- 24 kDa (MW of target protein)
-