AIFM3 antibody (Middle Region)
-
- Target See all AIFM3 Antibodies
- AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AIFM3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AIFM3 antibody was raised against the middle region of AIFM3
- Purification
- Affinity purified
- Immunogen
- AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
- Top Product
- Discover our top product AIFM3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))
- Alternative Name
- AIFM3 (AIFM3 Products)
- Synonyms
- nfrl-A antibody, MGC84340 antibody, AIFM3 antibody, LOC100150876 antibody, 2810401C16Rik antibody, AI840249 antibody, Aifl antibody, RGD1306028 antibody, AIFL antibody, apoptosis inducing factor, mitochondria associated 3 L homeolog antibody, apoptosis inducing factor, mitochondria associated 3 antibody, apoptosis-inducing factor, mitochondrion-associated 3 antibody, aifm3.L antibody, AIFM3 antibody, aifm3 antibody, Aifm3 antibody
- Background
- AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis
-