MPP5 antibody

Catalog No. ABIN631051

Product Details anti-MPP5 Antibody

Target: MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPP5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPP5 Blocking Peptide, catalog no. 33R-1585, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPP5

Target: MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))

Alternative Name: MPP5 (MPP5 Products)

Synonyms: PALS1 antibody, 3830420B02Rik antibody, AI255216 antibody, AI644496 antibody, Pals1 antibody, mpp5 antibody, nok antibody, MAGUK p55 subfamily member 5 antibody, membrane palmitoylated protein 5 antibody, membrane protein, palmitoylated 5 L homeolog antibody, membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) antibody, membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) antibody, Tsp_03061 antibody, MPP5 antibody, mpp5.L antibody, Mpp5 antibody, mpp5a antibody

Background: Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.

Molecular Weight: 77 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Tube Formation, Asymmetric Protein Localization