MPST antibody (Middle Region)
-
- Target See all MPST Antibodies
- MPST (Mercaptopyruvate Sulfurtransferase (MPST))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPST antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MPST antibody was raised against the middle region of MPST
- Purification
- Affinity purified
- Immunogen
- MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
- Top Product
- Discover our top product MPST Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPST Blocking Peptide, catalog no. 33R-2094, is also available for use as a blocking control in assays to test for specificity of this MPST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPST antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPST (Mercaptopyruvate Sulfurtransferase (MPST))
- Alternative Name
- MPST (MPST Products)
- Synonyms
- MST antibody, TST2 antibody, Mst antibody, mst antibody, tst antibody, tst2 antibody, fa96h11 antibody, mpst antibody, wu:fa96h11 antibody, mercaptopyruvate sulfurtransferase antibody, zgc:162544 antibody, mercaptopyruvate sulfurtransferase L homeolog antibody, mercaptopyruvate sulfurtransferase S homeolog antibody, MPST antibody, Mpst antibody, mpst antibody, zgc:162544 antibody, sseA antibody, mpst.L antibody, mpst.S antibody
- Background
- MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.
- Molecular Weight
- 33 kDa (MW of target protein)
-