Catenin antibody
-
- Target See all Catenin products
- Catenin
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Catenin Blocking Peptide, catalog no. 33R-7753, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Catenin
- Abstract
- Catenin Products
- Synonyms
- Bfc antibody, Catnb antibody, Mesc antibody, CTNNB antibody, MRD19 antibody, armadillo antibody, catenin (cadherin associated protein), beta 1 antibody, catenin beta 1 antibody, Ctnnb1 antibody, CTNNB1 antibody
- Background
- This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.
- Molecular Weight
- 108 kDa (MW of target protein)
-