ACADSB antibody (Middle Region)
-
- Target See all ACADSB Antibodies
- ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACADSB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACADSB antibody was raised against the middle region of ACADSB
- Purification
- Affinity purified
- Immunogen
- ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG
- Top Product
- Discover our top product ACADSB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACADSB Blocking Peptide, catalog no. 33R-3416, is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADSB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))
- Alternative Name
- ACADSB (ACADSB Products)
- Synonyms
- 2-mebcad antibody, acad7 antibody, sbcad antibody, DDBDRAFT_0185291 antibody, DDBDRAFT_0237707 antibody, DDB_0185291 antibody, DDB_0237707 antibody, 2-MEBCAD antibody, ACAD7 antibody, SBCAD antibody, 1300003O09Rik antibody, BB066609 antibody, acyl-CoA dehydrogenase, short/branched chain antibody, acyl-CoA dehydrogenase short/branched chain antibody, acyl-coenzyme A dehydrogenase, short/branched chain antibody, acyl-CoA dehydrogenase antibody, acyl-CoA dehydrogenase, short/branched chain L homeolog antibody, acyl-Coenzyme A dehydrogenase, short/branched chain antibody, ACADSB antibody, acadsb antibody, sce1166 antibody, acadsb.L antibody, Acadsb antibody
- Background
- Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-