PACRG antibody (Middle Region)
-
- Target See all PACRG Antibodies
- PACRG (PARK2 Co-Regulated (PACRG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PACRG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PACRG antibody was raised against the middle region of PACRG
- Purification
- Affinity purified
- Immunogen
- PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
- Top Product
- Discover our top product PACRG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PACRG (PARK2 Co-Regulated (PACRG))
- Alternative Name
- PACRG (PACRG Products)
- Synonyms
- PACRG antibody, GLUP antibody, HAK005771 antibody, PARK2CRG antibody, RP3-495O10.2 antibody, zgc:101786 antibody, RGD1561027 antibody, 1700008H23Rik antibody, parkin coregulated antibody, PARK2 co-regulated antibody, PARK2 coregulated antibody, PACRG antibody, pacrg antibody, Pacrg antibody
- Background
- PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.
- Molecular Weight
- 33 kDa (MW of target protein)
-