SNRK antibody (Middle Region)
-
- Target See all SNRK Antibodies
- SNRK (SNF Related Kinase (SNRK))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNRK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SNRK antibody was raised against the middle region of SNRK
- Purification
- Affinity purified
- Immunogen
- SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN
- Top Product
- Discover our top product SNRK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNRK Blocking Peptide, catalog no. 33R-8848, is also available for use as a blocking control in assays to test for specificity of this SNRK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRK (SNF Related Kinase (SNRK))
- Alternative Name
- SNRK (SNRK Products)
- Synonyms
- HSNFRK antibody, 2010012F07Rik antibody, AI448042 antibody, AW547029 antibody, E030034B15 antibody, R74830 antibody, mKIAA0096 antibody, SNF related kinase antibody, SNRK antibody, Snrk antibody
- Background
- SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.
- Molecular Weight
- 84 kDa (MW of target protein)
-