TKT antibody
-
- Target See all TKT Antibodies
- TKT (Transketolase (TKT))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TKT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
- Top Product
- Discover our top product TKT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TKT Blocking Peptide, catalog no. 33R-2753, is also available for use as a blocking control in assays to test for specificity of this TKT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TKT (Transketolase (TKT))
- Alternative Name
- TKT (TKT Products)
- Synonyms
- TK antibody, TKT1 antibody, p68 antibody, Dmel\\CG8036 antibody, anon-WO0118547.344 antibody, cb860 antibody, fb38f03 antibody, fj52f12 antibody, id:ibd3270 antibody, wu:cegs2794 antibody, wu:fb38f03 antibody, wu:fj52f12 antibody, tkt1 antibody, PSPTO0385 antibody, Tb08.11J15.550 antibody, xcc-b100_0966 antibody, transketolase antibody, CG8036 gene product from transcript CG8036-RB antibody, TransKeTolase homolog antibody, transketolase b antibody, transketolase L homeolog antibody, transketolase Tkt antibody, tkt antibody, TKT antibody, Tkt antibody, CG8036 antibody, tkt-1 antibody, tktb antibody, tkt.L antibody, tkt antibody, JK_RS05135 antibody, Tb927.8.6170 antibody, APH_RS01480 antibody
- Background
- TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.
- Molecular Weight
- 68 kDa (MW of target protein)
-