DSTYK antibody (Middle Region)

Catalog No. ABIN631202

Product Details anti-DSTYK Antibody

Target: DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DSTYK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RIPK5 antibody was raised against the middle region of RIPK5

Purification: Affinity purified

Immunogen: RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RIPK5 Blocking Peptide, catalog no. 33R-2341, is also available for use as a blocking control in assays to test for specificity of this RIPK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DSTYK

Target: DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))

Alternative Name: RIPK5 (DSTYK Products)

Synonyms: CAKUT1 antibody, DustyPK antibody, RIP5 antibody, RIPK5 antibody, A930019K20Rik antibody, C430014H23Rik antibody, C820013G01 antibody, Ripk5 antibody, ripk5 antibody, zgc:136421 antibody, DSTYK antibody, GB11994 antibody, DUSTYPK antibody, dual serine/threonine and tyrosine protein kinase antibody, receptor interacting protein kinase 5 antibody, dual serine/threonine and tyrosine protein kinase S homeolog antibody, DSTYK antibody, Dstyk antibody, dstyk antibody, Ripk5 antibody, dstyk.S antibody

Background: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.

Molecular Weight: 100 kDa (MW of target protein)