MTIF3 antibody (Middle Region)

Catalog No. ABIN631213

Product Details anti-MTIF3 Antibody

Target: MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTIF3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MTIF3 antibody was raised against the middle region of MTIF3

Purification: Affinity purified

Immunogen: MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTIF3 Blocking Peptide, catalog no. 33R-1612, is also available for use as a blocking control in assays to test for specificity of this MTIF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTIF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTIF3

Target: MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))

Alternative Name: MTIF3 (MTIF3 Products)

Synonyms: 2810012L14Rik antibody, AI414549 antibody, IF3mt antibody, fd12b09 antibody, wu:fd12b09 antibody, si:ch211-271b14.5 antibody, MGC145669 antibody, MGC145704 antibody, mitochondrial translational initiation factor 3 antibody, mitochondrial translational initiation factor 3 L homeolog antibody, Mtif3 antibody, MTIF3 antibody, mtif3 antibody, mtif3.L antibody

Background: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization