MTIF3 antibody (Middle Region)
-
- Target See all MTIF3 Antibodies
- MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTIF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MTIF3 antibody was raised against the middle region of MTIF3
- Purification
- Affinity purified
- Immunogen
- MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
- Top Product
- Discover our top product MTIF3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTIF3 Blocking Peptide, catalog no. 33R-1612, is also available for use as a blocking control in assays to test for specificity of this MTIF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTIF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))
- Alternative Name
- MTIF3 (MTIF3 Products)
- Synonyms
- 2810012L14Rik antibody, AI414549 antibody, IF3mt antibody, fd12b09 antibody, wu:fd12b09 antibody, si:ch211-271b14.5 antibody, MGC145669 antibody, MGC145704 antibody, mitochondrial translational initiation factor 3 antibody, mitochondrial translational initiation factor 3 L homeolog antibody, Mtif3 antibody, MTIF3 antibody, mtif3 antibody, mtif3.L antibody
- Background
- IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-