ESRRG antibody (N-Term)
-
- Target See all ESRRG Antibodies
- ESRRG (Estrogen-Related Receptor gamma (ESRRG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ESRRG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Estrogen-Related Receptor Gamma antibody was raised against the N terminal of ESRRG
- Purification
- Affinity purified
- Immunogen
- Estrogen-Related Receptor Gamma antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
- Top Product
- Discover our top product ESRRG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Estrogen-Related Receptor Gamma Blocking Peptide, catalog no. 33R-9206, is also available for use as a blocking control in assays to test for specificity of this Estrogen-Related Receptor Gamma antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESRRG (Estrogen-Related Receptor gamma (ESRRG))
- Alternative Name
- Estrogen-Related Receptor gamma (ESRRG Products)
- Synonyms
- ERR3 antibody, ERRgamma antibody, NR3B3 antibody, ESRRG antibody, USH2A antibody, DKFZp459J0417 antibody, err3 antibody, nr3b3 antibody, LOC100219115 antibody, errg antibody, errgamma antibody, esrrg antibody, errb/g antibody, esrrgl antibody, errbeta/gamma antibody, Errg antibody, mKIAA0832 antibody, estrogen related receptor gamma antibody, estrogen-related receptor gamma antibody, estrogen-related receptor gamma a antibody, estrogen-related receptor gamma b antibody, ESRRG antibody, esrrg antibody, Esrrg antibody, esrrga antibody, esrrgb antibody
- Background
- ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-