AKAP7 antibody
-
- Target See all AKAP7 Antibodies
- AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AKAP7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQV
- Top Product
- Discover our top product AKAP7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AKAP7 Blocking Peptide, catalog no. 33R-9178, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))
- Alternative Name
- AKAP7 (AKAP7 Products)
- Synonyms
- akap15 antibody, akap18 antibody, MGC83920 antibody, AKAP7 antibody, AKAP15 antibody, AKAP18 antibody, 6430401D08 antibody, AI662165 antibody, Akap18 antibody, BB170514 antibody, AKAP-18 antibody, AKAP18d antibody, Akap15 antibody, A-kinase anchoring protein 7 antibody, A-kinase anchoring protein 7 L homeolog antibody, A kinase (PRKA) anchor protein 7 antibody, AKAP7 antibody, akap7.L antibody, akap7 antibody, Akap7 antibody
- Background
- AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments.
- Molecular Weight
- 37 kDa (MW of target protein)
-