RNF165 antibody (Middle Region)
-
- Target See all RNF165 Antibodies
- RNF165 (Ring Finger Protein 165 (RNF165))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF165 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- RNF165 antibody was raised against the middle region of RNF165
- Purification
- Affinity purified
- Immunogen
- RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG
- Top Product
- Discover our top product RNF165 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF165 Blocking Peptide, catalog no. 33R-8857, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF165 (Ring Finger Protein 165 (RNF165))
- Alternative Name
- RNF165 (RNF165 Products)
- Synonyms
- RNF165 antibody, ARKL2 antibody, 2900024M11Rik antibody, AI427432 antibody, G630064H08Rik antibody, Gm96 antibody, RGD1560744 antibody, si:ch73-29c22.3 antibody, ring finger protein 165 antibody, ring finger protein 165a antibody, RNF165 antibody, Rnf165 antibody, rnf165a antibody
- Background
- RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.
- Molecular Weight
- 38 kDa (MW of target protein)
-