RFFL antibody (Middle Region)

Catalog No. ABIN631340

Product Details anti-RFFL Antibody

Target: RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFFL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RFFL antibody was raised against the middle region of RFFL

Purification: Affinity purified

Immunogen: RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFFL Blocking Peptide, catalog no. 33R-4301, is also available for use as a blocking control in assays to test for specificity of this RFFL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFFL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFFL

Target: RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))

Alternative Name: RFFL (RFFL Products)

Synonyms: MGC84042 antibody, RFFL antibody, Rffl antibody, 1700051E09Rik antibody, 4930516L10Rik antibody, BG080975 antibody, Carp2 antibody, CARP-2 antibody, CARP2 antibody, FRING antibody, RIFIFYLIN antibody, RNF189 antibody, RNF34L antibody, ring finger and FYVE like domain containing E3 ubiquitin protein ligase antibody, ring finger and FYVE-like domain containing E3 ubiquitin protein ligase L homeolog antibody, ring finger and FYVE-like domain containing 1 antibody, ring finger and FYVE like domain containing protein antibody, ring finger and FYVE-like domain containing E3 ubiquitin protein ligase antibody, RFFL antibody, rffl.L antibody, Rffl antibody

Background: RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL may bind phosphatidylinositol phosphates.

Molecular Weight: 40 kDa (MW of target protein)