STUB1 antibody (C-Term)

Catalog No. ABIN631354

Product Details anti-STUB1 Antibody

Target: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STUB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STUB1 antibody was raised against the C terminal of STUB1

Purification: Affinity purified

Immunogen: STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STUB1 Blocking Peptide, catalog no. 33R-9459, is also available for use as a blocking control in assays to test for specificity of this STUB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STUB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STUB1

Target: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Alternative Name: STUB1 (STUB1 Products)

Synonyms: CHIP antibody, HSPABP2 antibody, NY-CO-7 antibody, SDCCAG7 antibody, UBOX1 antibody, 0610033N24Rik antibody, 2210017D18Rik antibody, 2310040B03Rik antibody, AW046544 antibody, Chip antibody, wu:fc22f04 antibody, zgc:56076 antibody, STUB1 antibody, chip antibody, ATCHIP antibody, CARBOXYL TERMINUS OF HSC70-INTERACTING PROTEIN antibody, carboxyl terminus of HSC70-interacting protein antibody, STIP1 homology and U-box containing protein 1 antibody, STIP1 homology and U-Box containing protein 1 antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase L homeolog antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase antibody, STIP1 homology and U box-containing protein 1 antibody, carboxyl terminus of HSC70-interacting protein antibody, STUB1 antibody, Stub1 antibody, stub1 antibody, stub1.L antibody, LOC100282870 antibody, CHIP antibody

Background: STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Response to Water Deprivation