FBXW2 antibody (Middle Region)

Catalog No. ABIN631359

Product Details anti-FBXW2 Antibody

Target: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXW2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXW2 antibody was raised against the middle region of FBXW2

Purification: Affinity purified

Immunogen: FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXW2 Blocking Peptide, catalog no. 33R-8600, is also available for use as a blocking control in assays to test for specificity of this FBXW2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXW2

Target: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Alternative Name: FBXW2 (FBXW2 Products)

Synonyms: FBXW2 antibody, md6 antibody, fbw2 antibody, fwd2 antibody, MGC53244 antibody, FBW2 antibody, Fwd2 antibody, Md6 antibody, wu:fc72f10 antibody, zgc:110365 antibody, 2700071L08Rik antibody, MD6 antibody, F-box and WD repeat domain containing 2 antibody, F-box and WD repeat domain containing 2 L homeolog antibody, F-box and WD-40 domain protein 2 antibody, FBXW2 antibody, fbxw2 antibody, Fbxw2 antibody, fbxw2.L antibody

Background: F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.

Molecular Weight: 51 kDa (MW of target protein)