CRYBB3 antibody (Middle Region)

Catalog No. ABIN631403

Product Details anti-CRYBB3 Antibody

Target: CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRYBB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Crystallin Beta B3 antibody was raised against the middle region of CRYBB3

Purification: Affinity purified

Immunogen: Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Crystallin Beta B3 Blocking Peptide, catalog no. 33R-5223, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta B3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYBB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRYBB3

Target: CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))

Alternative Name: Crystallin beta B3 (CRYbB3 Products)

Synonyms: MGC84109 antibody, CATCN2 antibody, CRYB3 antibody, CTRCT22 antibody, AI852419 antibody, crystallin beta B3 L homeolog antibody, crystallin beta B3 antibody, crystallin, beta B3 antibody, crybb3.L antibody, CRYBB3 antibody, crybb3 antibody, Crybb3 antibody

Background: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens.

Molecular Weight: 24 kDa (MW of target protein)