CRYBB3 antibody (Middle Region)
-
- Target See all CRYBB3 (CRYbB3) Antibodies
- CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRYBB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Crystallin Beta B3 antibody was raised against the middle region of CRYBB3
- Purification
- Affinity purified
- Immunogen
- Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING
- Top Product
- Discover our top product CRYbB3 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Crystallin Beta B3 Blocking Peptide, catalog no. 33R-5223, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta B3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYBB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRYBB3 (CRYbB3) (Crystallin, beta B3 (CRYbB3))
- Alternative Name
- Crystallin beta B3 (CRYbB3 Products)
- Synonyms
- MGC84109 antibody, CATCN2 antibody, CRYB3 antibody, CTRCT22 antibody, AI852419 antibody, crystallin beta B3 L homeolog antibody, crystallin beta B3 antibody, crystallin, beta B3 antibody, crybb3.L antibody, CRYBB3 antibody, crybb3 antibody, Crybb3 antibody
- Background
- Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens.
- Molecular Weight
- 24 kDa (MW of target protein)
-