LDLRAP1 antibody (N-Term)
-
- Target See all LDLRAP1 Antibodies
- LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LDLRAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LDLRAP1 antibody was raised against the N terminal of LDLRAP1
- Purification
- Affinity purified
- Immunogen
- LDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK
- Top Product
- Discover our top product LDLRAP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LDLRAP1 Blocking Peptide, catalog no. 33R-10023, is also available for use as a blocking control in assays to test for specificity of this LDLRAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDLRAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
: "
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
-
- Target
- LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))
- Alternative Name
- LDLRAP1 (LDLRAP1 Products)
- Synonyms
- ARH antibody, ARH1 antibody, ARH2 antibody, FHCB1 antibody, FHCB2 antibody, AA691260 antibody, Arh antibody, Arh1 antibody, RGD1563417 antibody, arh antibody, arh1 antibody, arh2 antibody, fhcb1 antibody, fhcb2 antibody, xptb antibody, LDLRAP1 antibody, ldlrap1 antibody, sb:cb50 antibody, zgc:56121 antibody, zgc:158745 antibody, low density lipoprotein receptor adaptor protein 1 antibody, low density lipoprotein receptor adaptor protein 1 L homeolog antibody, low density lipoprotein receptor adaptor protein 1 S homeolog antibody, low density lipoprotein receptor adaptor protein 1a antibody, low density lipoprotein receptor adaptor protein 1b antibody, LDLRAP1 antibody, Ldlrap1 antibody, ldlrap1 antibody, ldlrap1.L antibody, ldlrap1.S antibody, ldlrap1a antibody, ldlrap1b antibody
- Background
- LDLRAP1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). LDLRAP1 may be required for LDL binding and internalization but not for receptor clustering in coated pits. LDLRAP1 may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-