KRT16 antibody
-
- Target See all KRT16 Antibodies
- KRT16 (Keratin 16 (KRT16))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KRT16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
- Top Product
- Discover our top product KRT16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cytokeratin 16 Blocking Peptide, catalog no. 33R-5363, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT16 (Keratin 16 (KRT16))
- Alternative Name
- Cytokeratin 16 (KRT16 Products)
- Synonyms
- CK16 antibody, FNEPPK antibody, K16 antibody, K1CP antibody, KRT16A antibody, NEPPK antibody, AI324768 antibody, Krt1-16 antibody, Ka16 antibody, KRT16 antibody, Krt16 antibody, keratin 16 antibody, keratin 16, type I S homeolog antibody, keratin, type I cytoskeletal 16 antibody, KRT16 antibody, Krt16 antibody, krt16.S antibody, LOC101108147 antibody, LOC100714013 antibody
- Background
- KRT16 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles.
- Molecular Weight
- 51 kDa (MW of target protein)
-